Out of stock
Get an email the moment Sermorelin is back.
One email when it’s back in stock. No spam, unsubscribe any time.
Shipping $9 · Free 2-day shipping over $75 · Ships from the US
For laboratory research use only. Not for human or animal consumption. Not a drug, food or cosmetic. By purchasing you confirm you are a qualified researcher.
Questions? Ask other researchers in our Discord.
No report is published yet for the current lot. Every report goes on the Lot reports page as soon as it is released.
Damaged, wrong or lost in transit? We replace or refund it. Refund policy
Sermorelin is GRF(1-29) amide, a synthetic 29-residue peptide with a C-terminal amide, supplied as a lyophilized powder.
| CAS | 86168-78-7 (free base) |
|---|---|
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 residues, C-terminal amide) |
| Formula | C149H246N44O42S |
| Mol. weight | ~3357.9 g/mol (free base) |
| Form | Lyophilized powder |
| Purity | ≥99% (HPLC), see lot COA |
| Storage | −20 °C, dry, away from light |
For laboratory research use only. Not for human or animal use.
Every lot goes to an independent US lab for purity and identity before it ships.
Each vial carries an ML lot number. Match it on our certificates page.
Ships from the US within 24 hours by USPS, 2–3 days in transit. Free shipping over $75.
No. For laboratory research use only. Not for human or animal use.
See what buyers say. Reviews and questions live in our Discord.
Sale price: $45.50Regular price: $65.00Save $19.50
Buy 2 Get 1
In stock · ships within 24 hours
Add to cartLot ML-002.1·99.11%Sale: −30%
Sale price: $49.00Regular price: $70.00Save $21.00
Buy 2 Get 1
In stock · ships within 24 hours
Add to cartLot ML-017·99.91%Sale: −30%
FromSale price: $21.00Regular price: $30.00Save $9.00
Buy 2 Get 1
In stock · ships within 24 hours
Choose size2 lots·99.5%+Sale: −30%
Sale price: $28.00Regular price: $40.00Save $12.00
Buy 2 Get 1
In stock · ships within 24 hours
Add to cartLot ML-004·99.53%Sale: −30%
Join free. Get a ping when a compound is back in stock, when a new lab report goes up, and when there’s a member-only drop.
Free, takes ten seconds, no purchase needed.
GHK-Cu 100mg + NL-RT 10mg + Bac Water 30 mL. Over 50% off, first order only. Open the link pinned in the Discord once you are in.
Research use only. Not for human or animal consumption.
